PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.228000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 231aa    MW: 26320.4 Da    PI: 8.6759
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.228000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G g+W++ ++  g+ R++k+c++rw +yl
   Cucsa.228000.1 14 KGAWTKEEDQRLINYIQIHGDGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding60.53.7e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEd+++++++++lG++ W++Ia++++ gRt++++k++w+++
   Cucsa.228000.1  67 RGNFTAEEDQIIINLHTLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.987961IPR017930Myb domain
SuperFamilySSF466897.91E-3012108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002495.2E-161461IPR001005SANT/Myb domain
CDDcd001674.00E-111661No hitNo description
PROSITE profilePS5129428.3862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2865116IPR009057Homeodomain-like
SMARTSM007173.1E-1766114IPR001005SANT/Myb domain
PfamPF002491.3E-1667111IPR001005SANT/Myb domain
CDDcd001671.01E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRSPCCEKQ HTNKGAWTKE EDQRLINYIQ IHGDGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TAEEDQIIIN LHTLLGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLYSRG  120
IDPQTHRPLA NNSSSSTGDF DRRREDSNSN SSSNSCLTTE VEENPPSNLN LELSIGLHPH  180
NQITKNTNPK GDDHQEAPVL FKFCSPQTEL ETQNFSSTPH MFRYYTPSPS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819120.0LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147356.21e-173PREDICTED: myb-related protein 330-like
SwissprotP813933e-85MYB08_ANTMA; Myb-related protein 308
SwissprotP813956e-85MYB30_ANTMA; Myb-related protein 330
TrEMBLA0A0B2PQ104e-91A0A0B2PQ10_GLYSO; Myb-related protein 308
TrEMBLI1KBT04e-91I1KBT0_SOYBN; Uncharacterized protein
TrEMBLV7AVZ14e-91V7AVZ1_PHAVU; Uncharacterized protein
STRINGGLYMA06G16820.11e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-85myb domain protein 4